PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000481448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 281aa    MW: 32201.4 Da    PI: 8.3945
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000481448genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.82.5e-5491341128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeel+v+yLk++++++++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nrat sgyWkatg+dk+++s +
  MDP0000481448   9 LPPGFRFHPTDEELIVFYLKNQASSRPCPV-SIIPEVDIYKFDPWELPEKAEFGENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYS-E 102
                    79****************************.89***************99999*****************************************.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++ vg+kk Lvfy+gr pkg+k+dW+mheyrl
  MDP0000481448 103 SKYVGVKKALVFYQGRPPKGVKSDWIMHEYRL 134
                    99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-654162IPR003441NAC domain
PROSITE profilePS5100560.9899162IPR003441NAC domain
PfamPF023651.4E-2610134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEAKRSSDLP PGFRFHPTDE ELIVFYLKNQ ASSRPCPVSI IPEVDIYKFD PWELPEKAEF  60
GENEWYFFTP RDRKYPNGVR PNRATVSGYW KATGTDKAIY SESKYVGVKK ALVFYQGRPP  120
KGVKSDWIMH EYRLSDSRKQ QPNKHLGSMR LDDWVLCRIY KKKHPGKAYL DQKVEEDQKI  180
EMRTPETAKA NEEQVMLKFP RACSITSLLD MDYLGPISQL FSDNISGYDF QTSMAGAGAG  240
QAQMFQFGEV PNYQNTTDSG KFQVTSAQTS VFNHQPWFGP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-7221648170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.145220.0fruit| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981270.0KF198127.1 Malus hupehensis NAC domain protein (NAC120) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280939.10.0NAC transcription factor 29-like
SwissprotO492551e-113NAC29_ARATH; NAC transcription factor 29
TrEMBLD9ZJ870.0D9ZJ87_MALDO; NAC domain class transcription factor
STRINGPOPTR_0008s08850.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-114NAC-like, activated by AP3/PI